PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400046163
Common NameLOC102598811
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 27310.1 Da    PI: 10.272
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400046163genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.47.8e-28959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krienk+ rqvtfskRr g+lKK +E+SvLCda+va+i+fss+gkl+eys+
  PGSC0003DMP400046163  9 KRIENKISRQVTFSKRRSGLLKKTNEISVLCDADVALIVFSSNGKLFEYST 59
                          79***********************************************96 PP

2K-box98.59.5e-33771718100
                 K-box   8 s..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                           +  l+++  e+++ e+ kL +++e Lqr++Rh++GedL+  +l+e q LeqqL+++lk++Rs+Kn+l++e+i++lqkkekelqe+n+ +
  PGSC0003DMP400046163  77 ErnLNTTYKENWTLEYPKLMARVELLQRNIRHFMGEDLDAFNLREFQGLEQQLDTALKRVRSRKNQLMHESISQLQKKEKELQERNNLI 165
                           224888999******************************************************************************** PP

                 K-box  95 rkklee 100
                           +kkl+e
  PGSC0003DMP400046163 166 SKKLKE 171
                           ***986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.8E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.272161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.18E-32289IPR002100Transcription factor, MADS-box
CDDcd002656.23E-40276No hitNo description
PRINTSPR004045.9E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-293859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-2683169IPR002487Transcription factor, K-box
PROSITE profilePS5129715.89185175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRGRVEMKR IENKISRQVT FSKRRSGLLK KTNEISVLCD ADVALIVFSS NGKLFEYSTQ  60
SSMENILERY ESYSSAERNL NTTYKENWTL EYPKLMARVE LLQRNIRHFM GEDLDAFNLR  120
EFQGLEQQLD TALKRVRSRK NQLMHESISQ LQKKEKELQE RNNLISKKLK ENEKKQIVQT  180
NPGQRSTMTF LLQSPSVTNL TIGGPSQATD ESQNRHGYNT LMPPWMFHHV HNKG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-19174173Myocyte-specific enhancer factor 2B
1tqe_Q7e-19174173Myocyte-specific enhancer factor 2B
1tqe_R7e-19174173Myocyte-specific enhancer factor 2B
1tqe_S7e-19174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755147e-68HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006365654.11e-175PREDICTED: truncated transcription factor CAULIFLOWER A-like
RefseqXP_006365655.11e-175PREDICTED: truncated transcription factor CAULIFLOWER A-like
SwissprotQ424295e-87AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLM1CIV11e-175M1CIV1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000683251e-174(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4992397
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.15e-84AGAMOUS-like 8
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]